GSTa5 anticorps (Middle Region)

N° du produit ABIN631548

Cet anticorps anti-GSTa5 est un anticorps Lapin Polyclonal détectant GSTa5 dans WB. Adapté pour Humain.

Aperçu rapide pour GSTa5 anticorps (Middle Region) (ABIN631548)

Antigène: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTa5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GSTa5 anticorps

Épitope: Middle Region

Specificité: GSTA5 antibody was raised against the middle region of GSTA5

Purification: Affinity purified

Immunogène: GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTA5 Blocking Peptide, (ABIN5613889), is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTa5

Antigène: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Autre désignation: GSTA5

Sujet: GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.

Poids moléculaire: 26 kDa (MW of target protein)